Anti-GCNT2 Antibody
Overview
This antibody targets human glucosaminyl (N-acetyl) transferase 2 (GCNT2), an enzyme involved in glycosylation pathways and I-branching of glycans. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for immunohistochemistry or immunocytochemistry.
Highlights
- Recognises human GCNT2 protein
- Sequence-defined peptide immunogen
- Validated for IHC or ICC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Glucosaminyl (N-acetyl) transferase 2 (GCNT2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- EVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAIDLLQWSKDT
- Validated applications
- ICC (SKU: HPA026776ICC); IHC (SKU: HPA026776IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for cellular or tissue localisation of GCNT2 in human samples by immunocytochemistry or immunohistochemistry. Supports research into glycosylation and carbohydrate biosynthesis.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

