Anti-IGF2BP3 Antibody
Overview
This antibody recognises human insulin-like growth factor 2 mRNA-binding protein 3 (IGF2BP3), an RNA-binding protein involved in mRNA localisation, stability, and translational regulation. It is generated against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Targets human IGF2BP3 protein
- Sequence-defined peptide immunogen
- Validated for WB or IHC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQ
- Validated applications
- WB (SKU: HPA002037WB); IHC (SKU: HPA002037IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Suitable for detection or localisation of IGF2BP3 in human samples by western blot or immunohistochemistry. Supports studies of post-transcriptional gene regulation and RNA biology.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
