Anti-ITGB4 Antibody
Overview
This antibody targets human integrin beta 4 (ITGB4), a transmembrane protein that forms part of hemidesmosomes and mediates cell–matrix adhesion in epithelial tissues. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Recognises human ITGB4 protein
- Sequence-defined peptide immunogen
- Validated for WB or IHC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Integrin beta 4 (ITGB4)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- IVDTVLMAPRSAKPALLKLTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPAGTATLGRRLVNITIIKEQAR
- Validated applications
- WB (SKU: HPA036349WB); IHC (SKU: HPA036349IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection or localisation of ITGB4 in human samples by western blot or immunohistochemistry. Supports research into epithelial adhesion, basement membrane interactions, and integrin signalling.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
