Anti-KIAA1462 Antibody
Overview
This antibody recognises human KIAA1462, a protein associated with endothelial cell junctions and vascular biology. It is generated against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Targets human KIAA1462 protein
- Sequence-defined peptide immunogen
- Validated for WB or IHC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- KIAA1462
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- LTPGQEQGASELEGSLGEASTIEIPPGESLQARAARILGIEVAVESLLPGIRRAGQNQPAEPDASACTPESPQEELLSRPAPADVPRVSTDAFYGRRKCGWTKSPLFVGDRDSARRAPQAFEHSDVDGVVTSTD
- Validated applications
- WB (SKU: HPA017956WB); IHC (SKU: HPA017956IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Suitable for detection or localisation of KIAA1462 in human samples by western blot or immunohistochemistry. Supports studies of endothelial junctions and vascular integrity.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
