Anti-KNSTRN Antibody
Overview
This antibody targets human kinetochore-localized astrin/SPAG5 binding protein (KNSTRN), a protein involved in chromosome segregation during mitosis. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Recognises human KNSTRN protein
- Sequence-defined peptide immunogen
- Validated for WB or IHC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Kinetochore-localized astrin/SPAG5 binding protein (KNSTRN)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ
- Validated applications
- WB (SKU: HPA042027WB); IHC (SKU: HPA042027IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection or localisation of KNSTRN in human samples by western blot or immunohistochemistry. Supports research into mitotic progression and chromosome dynamics.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
