Anti-LEMD2 Antibody
Overview
This antibody targets human LEM domain containing protein 2 (LEMD2), a nuclear envelope protein involved in nuclear architecture and chromatin organisation. It is generated against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for immunocytochemistry or immunohistochemistry.
Highlights
- Recognises human LEMD2 protein
- Sequence-defined peptide immunogen
- Validated for ICC or IHC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- LEM domain containing 2 (LEMD2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- EDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAHP
- Validated applications
- ICC (SKU: HPA017340ICC); IHC (SKU: HPA017340IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Suitable for cellular or tissue localisation of LEMD2 in human samples by immunocytochemistry or immunohistochemistry. Supports studies of nuclear envelope biology.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

