Anti-LRG1 Antibody
Overview
This antibody targets human leucine-rich alpha-2-glycoprotein 1 (LRG1), a secreted protein associated with inflammatory responses and vascular biology. It is generated against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Recognises human LRG1 protein
- Sequence-defined peptide immunogen
- Validated for WB or IHC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Leucine-rich alpha-2-glycoprotein 1 (LRG1)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSG
- Validated applications
- WB (SKU: HPA001888WB); IHC (SKU: HPA001888IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Suitable for detection or localisation of LRG1 in human samples by western blot or immunohistochemistry. Supports research into inflammation and vascular biology.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

