Anti-MAPT Antibody
Overview
This antibody recognises human microtubule-associated protein tau (MAPT), a protein involved in microtubule stabilisation and neuronal structure. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunocytochemistry.
Highlights
- Targets human MAPT (tau) protein
- Sequence-defined peptide immunogen
- Validated for WB or ICC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Microtubule-associated protein tau (MAPT)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- PLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVS
- Validated applications
- WB (SKU: HPA048895WB); ICC (SKU: HPA048895ICC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection or cellular localisation of MAPT in human samples by western blot or immunocytochemistry. Supports studies of neuronal structure and microtubule dynamics.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
