Anti-MARC1 Antibody
Overview
This antibody recognises human mitochondrial amidoxime reducing component 1 (MARC1), an enzyme associated with mitochondrial redox metabolism and detoxification pathways. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunocytochemistry.
Highlights
- Targets human MARC1 protein
- Sequence-defined peptide immunogen
- Validated for WB or ICC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Mitochondrial amidoxime reducing component 1 (MARC1)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- NQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGC
- Validated applications
- WB (SKU: HPA028702WB); ICC (SKU: HPA028702ICC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection or localisation of MARC1 in human samples by western blot or immunocytochemistry. Supports research into mitochondrial metabolism and redox biology.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
