Anti-MCU Antibody
Overview
This antibody recognises human mitochondrial calcium uniporter (MCU), a key component of mitochondrial calcium uptake and cellular calcium homeostasis. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunocytochemistry.
Highlights
- Targets human MCU protein
- Sequence-defined peptide immunogen
- Validated for WB or ICC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Mitochondrial calcium uniporter (MCU)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- HHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLV
- Validated applications
- WB (SKU: HPA016480WB); ICC (SKU: HPA016480ICC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection or localisation of MCU in human samples by western blot or immunocytochemistry. Supports studies of mitochondrial function and calcium signalling.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
