Anti-METTL4 Antibody
Overview
This antibody targets human methyltransferase-like protein 4 (METTL4), a putative methyltransferase implicated in RNA or protein methylation processes. It is generated against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for immunocytochemistry or immunohistochemistry.
Highlights
- Recognises human METTL4 protein
- Sequence-defined peptide immunogen
- Validated for ICC or IHC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Methyltransferase-like 4 (METTL4)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- NYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGV
- Validated applications
- ICC (SKU: HPA040061ICC); IHC (SKU: HPA040061IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Suitable for cellular or tissue localisation of METTL4 in human samples by immunocytochemistry or immunohistochemistry. Supports studies of methylation-related cellular processes.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
