Anti-MPST Antibody
Overview
This antibody recognises human mercaptopyruvate sulfurtransferase (MPST), an enzyme involved in sulfur metabolism and hydrogen sulfide production. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Targets human MPST protein
- Sequence-defined peptide immunogen
- Validated for WB or IHC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Mercaptopyruvate sulfurtransferase (MPST)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD
- Validated applications
- WB (SKU: HPA001240WB); IHC (SKU: HPA001240IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection or localisation of MPST in human samples by western blot or immunohistochemistry. Supports research into sulfur metabolism and redox biology.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
