Anti-NUP155 Antibody
Overview
This antibody recognises human nucleoporin 155 kDa (NUP155), a structural component of the nuclear pore complex involved in nucleocytoplasmic transport. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunocytochemistry.
Highlights
- Targets human NUP155 protein
- Sequence-defined peptide immunogen
- Validated for Western Blot (WB)w or Immunocytochemistry (ICC)
- Liquid antibody formulation
At-a-glance
- Target
- Nucleoporin 155 kDa (NUP155)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- TPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLL
- Validated applications
- WB ; ICC
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection or cellular localisation of NUP155 in human samples by western blot or immunocytochemistry. Supports studies of nuclear pore complex structure and transport.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

