Anti-SFTPC
Overview
The Atlas Antibodies Anti-SFTPC (HPA010928) is a rabbit polyclonal antibody raised against a recombinant Protein Epitope Signature Tag (PrEST) antigen corresponding to amino acids 62 to 196 of human surfactant protein C precursor, validated for Western blot & immunohistochemistry applications with affinity purification using the PrEST antigen as affinity ligand. Surfactant protein C is a 3.7 kDa hydrophobic protein produced exclusively by alveolar type 2 (AT2) cells as a 197 amino acid proprotein that undergoes post-translational modification to generate the mature active protein, playing a critical role in stabilising the pulmonary surfactant film and regulating phospholipid metabolism in the alveolar space. Part of the Prestige Antibodies portfolio powered by the Human Protein Atlas project, this antibody exhibits specific reactivity with human SFTPC with theoretical cross-reactivity to mouse (75% sequence identity, ENSMUSG00000022097) and rat (76% sequence identity, ENSRNOG00000011177), making it suitable for investigating surfactant protein biology, pulmonary disease mechanisms, and alveolar type 2 cell characterisation across respiratory biology, pulmonary pathology, and lung development research.
Highlights
- PrEST antigen affinity purification strategy ensures high specificity and low cross-reactivity through targeting of a unique 135 amino acid epitope signature region, minimising off-target binding whilst maintaining strong signal for SFTPC proprotein detection in alveolar type 2 cell lysates and lung tissue homogenates
- Enhanced validation through the Human Protein Atlas project provides extensive characterisation data including tissue expression patterns, subcellular localisation, and disease-specific staining profiles accessible via the Human Protein Atlas portal for informed experimental design and result interpretation
- Validated for Western blot applications enables detection of SFTPC proprotein (21 kDa) and processed forms in AT2 cell lysates, supporting investigations of surfactant protein processing, BRICHOS domain function, and mutations associated with familial pulmonary fibrosis and interstitial lung disease
- Theoretical cross-reactivity with mouse (75%) and rat (76%) SFTPC orthologues based on sequence identity analysis enables comparative studies across species in animal models of lung development, acute lung injury, and pulmonary fibrosis, though experimental validation in non-human species is recommended
At-a-glance
- Catalog Number
- HPA010928
- Product Line
- Triple A Polyclonals (Atlas Antibodies Advanced Polyclonals)
- Antibody Type
- Rabbit polyclonal
- Host Species
- Rabbit
- Target Antigen
- Human surfactant protein C (SFTPC)
- Alternative Names
- SP-C, PSP-C, SFTP2, BRICD6, SMDP2
- Immunogen
- Recombinant PrEST antigen (amino acids 62-196 of human SFTPC precursor)
- Immunogen Sequence
- PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCG
- Purification Method
- Affinity purified using PrEST antigen
- Conjugation
- Unconjugated
- Validated Applications
- Western blot (WB) & Immunohistochemistry (ICH)
- Species Reactivity
- Human
- Interspecies Reactivity (Theoretical)
- Mouse (ENSMUSG00000022097, 75% identity), Rat (ENSRNOG00000011177, 76% identity)
- Clonality
- Polyclonal
- Buffer
- Buffered aqueous glycerol solution
- RRID
- AB_1857425
- Condition
- Surplus/second-hand
Applications
This antibody is suitable for Western blot analysis of surfactant protein C expression in alveolar type 2 cell lysates, lung tissue homogenates, and bronchoalveolar lavage samples for investigations of pulmonary surfactant biology, lung development, and respiratory disease mechanisms. It serves research into familial pulmonary fibrosis associated with SFTPC mutations, interstitial lung disease pathogenesis, idiopathic pulmonary fibrosis, combined pulmonary fibrosis and emphysema syndrome, acute respiratory distress syndrome, and alveolar type 2 cell differentiation. The antibody enables studies of SFTPC proprotein processing, BRICHOS domain function, and mutation effects on protein folding and endoplasmic reticulum stress across respiratory biology, pulmonary pathology, developmental biology, and pharmaceutical research laboratories investigating lung diseases and regenerative medicine applications.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
