Anti-SLC7A1 Antibody
Overview
This antibody targets human solute carrier family 7 member 1 (SLC7A1), a cationic amino acid transporter of the y+ system involved in cellular uptake of basic amino acids. It is generated using a sequence-defined immunogen to support selective protein detection.
Highlights
- Targets human SLC7A1 protein
- Sequence-specific immunogen
- Validated for western blot (WB)
- Buffered glycerol-based liquid formulation
At-a-glance
- Target
- Solute carrier family 7 member 1 (SLC7A1)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of SLC7A1 in human-derived samples. It supports research into amino acid transport and membrane transporter biology.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

