Anti-SOX2 Antibody
Overview
This antibody recognises human SRY-box transcription factor 2 (SOX2), a key regulator of pluripotency and neural development. It is raised against a defined immunogen sequence for selective protein detection.
Highlights
- Targets human SOX2 protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- SRY-box transcription factor 2 (SOX2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for western blot analysis of SOX2 in human samples. It supports research into stem cell biology and transcriptional regulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
