Anti-SPARC Antibody
Overview
This antibody recognises human SPARC (osteonectin), a secreted glycoprotein involved in extracellular matrix organisation and cell–matrix interactions. It is raised against a defined immunogen sequence for selective detection.
Highlights
- Targets human SPARC protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- Secreted protein acidic cysteine-rich (SPARC)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- QEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDY
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for western blot analysis of SPARC in human samples. It supports research into extracellular matrix biology and tissue remodelling.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
