Anti-SRSF6 Antibody
Overview
This antibody recognises human serine/arginine-rich splicing factor 6 (SRSF6), a nuclear protein involved in mRNA splicing regulation. It is raised against a defined immunogen sequence for selective protein detection.
Highlights
- Targets human SRSF6 protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- Serine/arginine-rich splicing factor 6 (SRSF6)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- KDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSR
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for western blot analysis of SRSF6 in human-derived samples. It supports research into RNA splicing and post-transcriptional regulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
