Anti-STAM2 Antibody
Overview
This antibody targets human signal transducing adaptor molecule 2 (STAM2), a protein involved in endosomal sorting and cytokine signalling. It is generated using a sequence-defined immunogen to support selective detection.
Highlights
- Targets human STAM2 protein
- Sequence-specific immunogen
- Validated for western blot (WB)
- Buffered glycerol-based formulation
At-a-glance
- Target
- Signal transducing adaptor molecule 2 (STAM2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- EAPVYSVYSKLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSLGPDQIGPLRSLPPNVNSSVTA
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot detection of STAM2 in human samples. It supports research into intracellular trafficking and signal transduction.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
