Anti-STIM1 Antibody
Overview
This antibody recognises human stromal interaction molecule 1 (STIM1), a calcium sensor essential for store-operated calcium entry. It is raised against a defined immunogen sequence for selective protein detection.
Highlights
- Targets human STIM1 protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- Stromal interaction molecule 1 (STIM1)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- TAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSH
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for western blot analysis of STIM1 in human-derived samples. It supports research into calcium signalling and cellular homeostasis.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

