Anti-SULF1 Antibody
Overview
This antibody targets human sulfatase 1 (SULF1), an extracellular enzyme involved in heparan sulfate modification. It is generated against a defined immunogen sequence to support selective detection by immunoblotting.
Highlights
- Targets human SULF1 protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid glycerol-based formulation
At-a-glance
- Target
- Sulfatase 1 (SULF1)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- QPRNIAKRHDEGHKGPRDLQASSGGNRGRMLADSSNAVGPPTTVRVTHKCFILPNDSIHCERELYQSARAWKDHKAYIDKEIEALQD
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of SULF1 in human-derived samples. It supports research into extracellular matrix regulation and growth factor signalling.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
