Anti-THOC2 Antibody
Overview
This antibody targets human THO complex subunit 2 (THOC2), a core component of the TREX complex involved in mRNA processing and export. It is generated against a sequence-defined immunogen for selective detection by immunoblotting.
Highlights
- Targets human THOC2 protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid glycerol-based formulation
At-a-glance
- Target
- THO complex subunit 2 (THOC2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- VHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGYSGQLKSRKSYMIPENEFHHKDPPPRNAVASV
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of THOC2 in human-derived samples. It supports research into RNA processing and nuclear export mechanisms.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

