Anti-TJP2 Antibody
Overview
This antibody recognises human tight junction protein 2 (TJP2), a cytoplasmic scaffolding protein involved in tight junction assembly and epithelial barrier regulation. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate product variants are validated for western blotting or immunohistochemistry.
Highlights
- Targets human TJP2 protein
- Sequence-defined peptide immunogen
- Validated for Western Blot (WB) or Immunohistochemistry (IHC) depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Tight junction protein 2 (TJP2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG
- Validated applications
- WB (SKU: HPA001813WB); IHC (SKU: HPA001813IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection and localisation of TJP2 in human samples by western blot or immunohistochemistry, depending on product variant. Supports studies of epithelial junctions and barrier function.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

