Anti-TPBG Antibody
Overview
This antibody targets human trophoblast glycoprotein (TPBG), also known as 5T4, a cell surface glycoprotein associated with cell motility and adhesion. It is generated against a sequence-defined immunogen for selective protein detection.
Highlights
- Targets human TPBG (5T4) protein
- Sequence-specific immunogen
- Validated for western blot (WB)
- Liquid glycerol-based formulation
At-a-glance
- Target
- Trophoblast glycoprotein (TPBG / 5T4)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- LVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILP
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of TPBG in human-derived samples. It supports research into cell surface glycoproteins and tumour-associated antigens.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
