Anti-TPX2 Antibody
Overview
This antibody recognises human TPX2 (targeting protein for Xklp2), a microtubule-associated protein involved in mitotic spindle assembly. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate product variants are validated for western blotting or immunohistochemistry.
Highlights
- Targets human TPX2 protein
- Sequence-defined peptide immunogen
- Validated for Western Blot (WB) or Immunohistochemistry (IHC) depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- TPX2, microtubule-associated
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKD
- Validated applications
- WB (SKU: HPA005487WB); IHC (SKU: HPA005487IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection of TPX2 in human samples by western blot or immunohistochemistry, depending on product variant. Suitable for studies of mitosis, spindle organisation, and cell cycle regulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
