Anti-TRIOBP Antibody
Overview
This antibody targets human TRIO and F-actin binding protein (TRIOBP), a cytoskeletal-associated protein involved in actin organisation. It is raised against a defined immunogen sequence for immunoblot detection.
Highlights
- Targets human TRIOBP protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid glycerol-based formulation
At-a-glance
- Target
- TRIO and F-actin binding protein (TRIOBP)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- ATDSRTPEVPAGEGPRRGLGAPLTEDQQNRLSEEIEKKWQELEKLPLRENKRVPLTALLNQSRGERRGPPSDGHEALEKEVQALRAQLEAWRLQGEAPQSA
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of TRIOBP in human samples. It supports research into cytoskeletal organisation and actin dynamics.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
