Anti-TRMT10C Antibody
Overview
This antibody targets human tRNA methyltransferase 10 homolog C (TRMT10C), a mitochondrial protein involved in tRNA processing and modification. It is raised against a sequence-defined immunogen for selective protein detection by immunoblotting.
Highlights
- Targets human TRMT10C protein
- Sequence-specific immunogen
- Validated for western blot (WB)
- Liquid glycerol-based formulation
At-a-glance
- Target
- tRNA methyltransferase 10 homolog C (TRMT10C)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- SVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATR
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of TRMT10C in human-derived samples. It supports research into mitochondrial RNA processing.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

