Anti-UBR3 Antibody
Overview
This antibody targets human ubiquitin protein ligase E3 component n-recognin 3 (UBR3), a protein associated with ubiquitin-dependent regulatory pathways. It is raised against a defined immunogen sequence and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Recognises human UBR3 protein
- Sequence-defined peptide immunogen
- Validated for Western Blot (WB) or Immunohistochemistry (IHC) depending on SKU.
- Liquid antibody formulation
At-a-glance
- Target
- Ubiquitin protein ligase E3 component n-recognin 3 (UBR3)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- DRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQE
- Validated applications
- WB (SKU: HPA035390WB); IHC (SKU: HPA035390IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Suitable for detection and localisation of UBR3 in human samples by western blot or immunohistochemistry. Supports research into ubiquitin ligase function and protein regulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

