Anti-USP25 Antibody
Overview
This antibody recognises human ubiquitin specific peptidase 25 (USP25), a deubiquitinating enzyme involved in immune signalling and protein turnover. It is raised against a sequence-defined immunogen for immunoblot detection.
Highlights
- Targets human USP25 protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Buffered liquid formulation
At-a-glance
- Target
- Ubiquitin specific peptidase 25 (USP25)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- YRKFRETTMYLIIGLENFQRESYIDSLLFLICAYQNNKELLSKGLYRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNNGLIIMNEFIVPFLPLLLVDEMEEKDILAVEDMRNRWCSYLGQEMEPHLQEKLTDFLPKLLDCSMEIK
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of USP25 in human-derived samples. It supports studies of ubiquitin-dependent signalling pathways.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
