Anti-VSIG2 Antibody
Overview
This antibody recognises human V-set and immunoglobulin domain containing 2 (VSIG2), a membrane protein of the immunoglobulin superfamily. It is raised against a defined immunogen sequence for immunoblot detection.
Highlights
- Targets human VSIG2 protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Buffered liquid formulation
At-a-glance
- Target
- V-set and immunoglobulin domain containing 2 (VSIG2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- GQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQ
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of VSIG2 in human samples. It supports studies of immunoglobulin domain-containing proteins.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

