Anti-ZNF581 Antibody
Overview
This antibody targets human zinc finger protein 581 (ZNF581), a nuclear protein thought to participate in transcriptional regulation. It is raised against a sequence-defined immunogen and is validated for protein detection in denatured samples.
Highlights
- Targets human ZNF581 protein
- Defined peptide immunogen sequence
- Validated for western blot analysis
- Supplied in a glycerol-based liquid format
At-a-glance
- Target
- Zinc finger protein 581 (ZNF581)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- PYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDI
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot detection of ZNF581 in human-derived samples. It supports research into zinc finger proteins and transcription-associated mechanisms.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
