Anti-ZNF598 Antibody
Overview
This antibody is directed against human zinc finger protein 598 (ZNF598), a ribosome-associated protein involved in translational quality control and ubiquitin-mediated signalling. It is generated against a defined immunogen sequence and is validated for detection of denatured protein.
Highlights
- Targets human ZNF598 protein
- Sequence-defined peptide immunogen
- Validated for western blot analysis
- Supplied as a liquid glycerol-based formulation
At-a-glance
- Target
- Zinc finger protein 598 (ZNF598)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- VVGGEDYEEVDRYSRQGRVARAGTRGAQQSRRGSWRYKREEEDREVAAAVRASVAAQQQEEARRSEDQEEGGRPKKEEAAARGPEDPRGPRRSPRTQGEGPGPKETSTNGPVSQ
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
Suitable for western blot detection of ZNF598 in human-derived samples. This antibody supports studies of translational control, ribosome-associated quality surveillance, and ubiquitin-related pathways.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
