Anti-ALDH18A1 Antibody
Overview
This Anti-ALDH18A1 antibody is a polyclonal primary antibody developed for detection of aldehyde dehydrogenase 18 family member A1 (ALDH18A1). It has been validated for Western blot analysis and demonstrates a protein expression pattern comparable to an independent antibody targeting the same protein. The antibody is generated against a defined protein sequence to support specificity.
Highlights
- Polyclonal primary antibody targeting ALDH18A1
- Validated for Western blot applications
- Sequence-defined immunogen
- Documented interspecies reactivity
At-a-glance
- Product type
- Primary antibody
- Target
- ALDH18A1
- Clonality
- Polyclonal
- Immunogen sequence
- SVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRD
- Interspecies reactivity
- Mouse (97%), Rat (97%)
- Buffer composition
- 40% glycerol in PBS (pH 7.2) with preservative
- Manufacturer
- Atlas Antibodies
- Condition
- New / Unused
Applications
Used for detection and relative quantification of ALDH18A1 protein expression by Western blotting. Applicable in molecular biology and protein expression studies involving human and cross-reactive mammalian samples.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
