Anti-PHGDH Antibody
Overview
This Anti-PHGDH antibody is a polyclonal primary antibody developed for detection of phosphoglycerate dehydrogenase (PHGDH). It has been validated for immunohistochemical staining in human skin tissue, showing strong cytoplasmic positivity in squamous epithelial cells. The antibody is raised against a defined protein sequence to support target specificity.
Highlights
- Polyclonal primary antibody targeting PHGDH
- Validated for immunohistochemistry applications
- Strong cytoplasmic staining in human skin tissue
- Defined protein immunogen sequence
At-a-glance
- Product type
- Primary antibody
- Target
- PHGDH
- Clonality
- Polyclonal
- Immunogen sequence
- KVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNT
- Interspecies reactivity
- Mouse (100%), Rat (98%)
- Buffer composition
- 40% glycerol in PBS (pH 7.2) with preservative
- Manufacturer
- Atlas Antibodies
- Condition
- New / Unused
Applications
Used for localisation and qualitative assessment of PHGDH protein expression in tissue sections by immunohistochemistry. Applicable in studies of cellular metabolism and epithelial tissue biology.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
