Anti-MYBPC3 Antibody
Overview
This Anti-MYBPC3 antibody is a polyclonal primary antibody developed for detection of myosin-binding protein C, cardiac type (MYBPC3). It has been validated for immunohistochemistry analysis in human heart muscle and prostate tissues, with corresponding RNA expression data available for comparison. The antibody is generated against a defined protein sequence to support target specificity.
Highlights
- Polyclonal primary antibody targeting MYBPC3
- Validated for immunohistochemistry applications
- Tested in human cardiac and prostate tissues
- Defined peptide immunogen sequence
At-a-glance
- Product type
- Primary antibody
- Target
- MYBPC3
- Clonality
- Polyclonal
- Immunogen sequence
- TGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDA
- Interspecies reactivity
- Mouse (93%), Rat (93%)
- Buffer composition
- 40% glycerol in PBS (pH 7.2) with preservative
- Manufacturer
- Atlas Antibodies
- Condition
- New / Unused
Applications
Used for localisation and qualitative assessment of MYBPC3 protein expression in human tissue sections by immunohistochemistry. Applicable in studies of cardiac muscle structure and tissue-specific protein expression.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
