Anti-TRIP13 Antibody
Overview
This Anti-TRIP13 antibody is a polyclonal primary antibody developed for detection of thyroid hormone receptor interactor 13 (TRIP13). It has been validated for Western blot analysis using control and TRIP13 over-expression lysates in HEK293T cells, supporting assessment of specific protein expression. The antibody is raised against a defined protein sequence to support target specificity.
Highlights
- Polyclonal primary antibody targeting TRIP13
- Validated for Western blot applications
- Tested using over-expression cell lysates
- Defined protein immunogen sequence
At-a-glance
- Product type
- Primary antibody
- Target
- TRIP13
- Clonality
- Polyclonal
- Immunogen sequence
- SKWFSESGKLVTKMFQKIQDLIDDKDALVFVLIDEVESLTAARNACRAGTEPSDAIRVVNAVLTQIDQIKRHSNVVILTTSNITEKIDVAFVDRADIKQYIGPPSA
- Interspecies reactivity
- Mouse (98%), Rat (98%)
- Buffer composition
- 40% glycerol in PBS (pH 7.2) with preservative
- Manufacturer
- Atlas Antibodies
- Condition
- New / Unused
Applications
Used for detection and comparison of TRIP13 protein expression by Western blotting. Applicable in studies of cell cycle regulation and protein over-expression models.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

