Anti-POU1F1 Antibody
Overview
This Anti-POU1F1 antibody is a polyclonal primary antibody developed for detection of POU class 1 homeobox 1 (POU1F1). It has been validated for immunohistochemical analysis in multiple human tissues, including liver, pancreas, pituitary gland, and tonsil, showing comparable protein distribution to an independent antibody. The antibody is raised against a defined protein sequence to support target specificity.
Highlights
- Polyclonal primary antibody targeting POU1F1
- Validated for immunohistochemistry applications
- Comparable tissue staining to independent antibody
- Defined peptide immunogen sequence
At-a-glance
- Product type
- Primary antibody
- Target
- POU1F1
- Clonality
- Polyclonal
- Immunogen sequence
- FPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGS
- Interspecies reactivity
- Mouse (94%), Rat (95%)
- Buffer composition
- 40% glycerol in PBS (pH 7.2) with preservative
- Manufacturer
- Atlas Antibodies
- Condition
- New / Unused
Applications
Used for localisation and qualitative assessment of POU1F1 protein expression in human tissue sections by immunohistochemistry. Applicable in studies of endocrine tissue biology and transcription factor expression.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
