Anti-ATXN2 Antibody
Overview
This Anti-ATXN2 antibody is a polyclonal primary antibody developed for detection of ataxin-2 (ATXN2). It has been validated for immunohistochemistry analysis in human testis and skeletal muscle tissues, with corresponding RNA expression data available for reference. The antibody is generated against a defined immunogen sequence to support target specificity.
Highlights
- Polyclonal primary antibody targeting ATXN2
- Validated for immunohistochemistry applications
- Defined protein immunogen sequence
- Reported interspecies reactivity with rodent proteins
At-a-glance
- Product type
- Primary antibody
- Target
- ATXN2
- Clonality
- Polyclonal
- Immunogen sequence
- TPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPTHAQPGLVSSSATQYGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHTPHPQPSATPTGQQQSQHGGSHPAPS
- Interspecies reactivity
- Mouse (97%), Rat (96%)
- Buffer composition
- 40% glycerol in PBS (pH 7.2) with preservative
- Manufacturer
- Atlas Antibodies
- Condition
- New / Unused
Applications
Used for localisation and qualitative assessment of ATXN2 protein expression in tissue sections by immunohistochemistry. Applicable in studies of neurological proteins and tissue-specific expression.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
