Anti-RSPH4A Antibody
Overview
This Anti-RSPH4A antibody is a polyclonal primary antibody developed for detection of radial spoke head 4 homolog A (RSPH4A). It has been validated for immunohistochemistry analysis in human fallopian tube and liver tissues, with corresponding RNA expression data available for reference. The antibody is raised against a defined immunogen sequence to support specificity.
Highlights
- Polyclonal primary antibody targeting RSPH4A
- Validated for immunohistochemistry applications
- Defined peptide immunogen sequence
- Documented interspecies reactivity
At-a-glance
- Product type
- Primary antibody
- Target
- RSPH4A
- Clonality
- Polyclonal
- Immunogen sequence
- RPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSPQSRAKTPLGGPAGPETSSPAPVSPREPSSSP
- Interspecies reactivity
- Mouse (41%), Rat (37%)
- Buffer composition
- 40% glycerol in PBS (pH 7.2) with preservative
- Manufacturer
- Atlas Antibodies
- Condition
- New / Unused
Applications
Used for localisation and qualitative assessment of RSPH4A protein expression in human tissue sections by immunohistochemistry. Applicable in studies of ciliary function and tissue-specific protein expression.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

