Anti-BARHL1
Overview
The Anti-BARHL1 antibody (HPA004809) is a rabbit Triple A Polyclonal reagent targeting human BarH-like homeobox 1 (BARHL1), a transcription factor implicated in neuronal development and cellular differentiation. The antibody is raised against a recombinant protein fragment corresponding to a BARHL1 low-complexity and regulatory region. Validated exclusively for Western blot applications, it enables detection of BARHL1 in human protein extracts.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human BARHL1
- Validated only for Western blot (WB)
- Recombinant antigen fragment defining target specificity
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- BARHL1 (BarH-like homeobox 1)
- Antibody type
- Triple A Polycloncal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- LELSPRSESSSDCSSPASPGRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSP
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of BARHL1 in human lysates, aiding studies of transcriptional regulation, neural lineage specification, and developmental signalling pathways. It is suitable for evaluating BARHL1 expression across a range of research models involving neuronal tissues or differentiation processes.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
