Anti-BICC1
Overview
The Anti-BICC1 antibody (HPA045212) is a rabbit Triple A Polyclonal reagent targeting human BICC1, an RNA-binding protein involved in post-transcriptional regulation, developmental signalling, and cytoplasmic ribonucleoprotein complex assembly. The antibody is raised against a recombinant BICC1 protein fragment corresponding to a defined low-complexity sequence region rich in regulatory motifs. Validated exclusively for Western blot applications, it enables detection of BICC1 in human protein lysates.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human BICC1
- Validated only for Western blot (WB)
- Recombinant antigen fragment representing regulatory sequence motifs
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- BICC1 (BicC family RNA binding protein 1)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- NAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRA
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of BICC1 in human lysates, aiding studies of RNA-binding protein networks, post-transcriptional gene regulation, and developmental signalling pathways. It is suitable for assessing BICC1 expression in diverse physiological and experimental contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
