Anti-IER3IP1 Antibody
Overview
This antibody is raised against a protein sequence from human IER3IP1 (immediate early response 3 interacting protein 1). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous IER3IP1 in human-derived samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human IER3IP1
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined IER3IP1 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- IER3IP1 (immediate early response 3 interacting protein 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- IAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of IER3IP1 in human-derived cell samples. It may be used in research examining stress-responsive signalling pathways and protein–protein interactions. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
