Anti-IL13 Antibody
Overview
This antibody is raised against a protein sequence from human IL13 (interleukin 13). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous IL13 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human interleukin 13
- Validated application: Western blot (WB)
- Immunogen derived from a defined IL13 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- IL13 (interleukin 13)
- Alternative gene names
- ALRH, BHR1, IL-13, MGC116786, MGC116788, MGC116789, P600
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- PGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of IL13 in human-derived samples. It may be used in research examining cytokine expression and immune signalling pathways. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
