Anti-NAA15 Antibody
Overview
This antibody is raised against a protein sequence from human NAA15 (N(alpha)-acetyltransferase 15, NatA auxiliary subunit). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NAA15 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human N(alpha)-acetyltransferase 15 (NatA auxiliary subunit)
- Validated application: Western blot (WB)
- Immunogen derived from a defined NAA15 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NAA15 (N(alpha)-acetyltransferase 15, NatA auxiliary subunit)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- ALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKG
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of NAA15 in human-derived samples. It may be used in research examining N-terminal protein acetylation and NatA complex function in cellular protein regulation. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
