Anti-RBM15 Rabbit Polyclonal Antibody
Overview
This rabbit polyclonal antibody targets human RNA binding motif protein 15 (RBM15), which plays a role in RNA processing and transcriptional regulation. It is generated using a sequence-defined immunogen to support selective protein detection. The antibody is supplied in liquid format.
Highlights
- Rabbit polyclonal antibody against RBM15
- Sequence-defined immunogen
- Validated for western blot (WB)
- Buffered glycerol-based formulation
At-a-glance
- Target
- RNA binding motif protein 15 (RBM15)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- DTYPPSASVVGASVGGHRHPPGGGGGQRSLSPGGAALGYRDYRLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVGAGAGAAPFREVDEISPEDDQRANRTLFL
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of RBM15 in human samples. It supports research into RNA metabolism and gene expression regulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
