Anti-SELENOS Antibody
Overview
This antibody targets human selenoprotein S (SELENOS), an endoplasmic reticulum membrane protein involved in protein quality control and inflammatory responses. It is generated using a sequence-defined immunogen to support selective detection. The antibody is supplied as a liquid reagent.
Highlights
- Targets human SELENOS protein
- Sequence-specific immunogen
- Validated for western blot (WB)
- Buffered glycerol-based formulation
At-a-glance
- Target
- Selenoprotein S (SELENOS)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of SELENOS in human-derived samples. It supports studies of endoplasmic reticulum stress and protein homeostasis.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
