Anti-SLC27A6 Antibody
Overview
This antibody targets human solute carrier family 27 member 6 (SLC27A6), a fatty acid transport protein involved in lipid uptake and metabolism. It is generated using a sequence-defined immunogen to support selective detection.
Highlights
- Targets human SLC27A6 protein
- Sequence-specific immunogen
- Validated for western blot (WB)
- Buffered glycerol-based formulation
At-a-glance
- Target
- Solute carrier family 27 member 6 (SLC27A6)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- LGTVEEILPSLSENISVWGMKDSVPQGVISLKEKLSTSPDEPVPRSHHVVSLLKSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVELGATCVLKKKFSASQFWS
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of SLC27A6 in human-derived samples. It supports studies of fatty acid transport and lipid metabolism.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
