Anti-PEX3 Antibody
Overview
This antibody is raised against human PEX3 (peroxisomal biogenesis factor 3), a membrane-associated protein essential for peroxisome formation and maintenance. It is generated using a defined PEX3-derived immunogen sequence and supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio. The manufacturer reports validation of this antibody for immunohistochemistry.
Highlights
- Targets human peroxisomal biogenesis factor 3 (PEX3)
- Validated application: Immunohistochemistry (IHC)
- Immunogen derived from a defined region of the PEX3 protein
- Supplied in a glycerol-based phosphate buffer formulation
At-a-glance
- Target protein
- PEX3 (peroxisomal biogenesis factor 3)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- LDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of PEX3 in human tissue samples. It may support research into peroxisome biogenesis, cellular metabolism, and organelle dynamics. Validation has not been reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
