Anti-PC Antibody
Overview
This antibody is directed against human pyruvate carboxylase (PC), a mitochondrial enzyme involved in gluconeogenesis and anaplerotic metabolic pathways. It is raised against a defined PC-derived immunogen sequence and supplied as part of the Atlas Antibodies Triple A Polyclonals range. The manufacturer reports validation of this antibody for immunohistochemistry.
Highlights
- Targets human pyruvate carboxylase (PC)
- Validated application: Immunohistochemistry (IHC)
- Immunogen based on a defined region of the PC protein
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- PC (pyruvate carboxylase)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- GADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQ
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of pyruvate carboxylase in human tissue samples. It may be applied in studies of cellular metabolism and mitochondrial function. Use is limited to the application validated by the manufacturer.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
