Anti-PAXBP1 Antibody
Overview
This antibody is raised against a defined region of human PAXBP1 (PAX3 and PAX7 binding protein 1), a nuclear protein implicated in transcriptional regulation through interactions with paired box transcription factors. It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous PAXBP1 in human-derived samples. The manufacturer reports validation for immunohistochemistry.
Highlights
- Targets human PAXBP1 (PAX3 and PAX7 binding protein 1)
- Validated application: Immunohistochemistry (IHC)
- Immunogen derived from a defined PAXBP1 protein sequence
- Formulated in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PAXBP1 (PAX3 and PAX7 binding protein 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- ALSSLNVLRPGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEKSQRQKIAEEIGIEGSDDDALVTGEQDEELSRWEQEQIRKGINIPQVQASQPAEVNMYYQNT
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of PAXBP1 in human tissue sections. It may support research into transcriptional regulation and developmental biology. Validation has not been reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
